Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516

  1. Avatar for jprime1789 181. jprime1789 Lv 1 1 pt. 3,821
  2. Avatar for ume 182. ume Lv 1 1 pt. 3,821
  3. Avatar for fpc 183. fpc Lv 1 1 pt. 3,821
  4. Avatar for nikiijiang 184. nikiijiang Lv 1 1 pt. 3,821
  5. Avatar for lucans1 185. lucans1 Lv 1 1 pt. 3,821
  6. Avatar for joshmiller 186. joshmiller Lv 1 1 pt. 3,821
  7. Avatar for Sciren 187. Sciren Lv 1 1 pt. 3,821
  8. Avatar for el carlitos 188. el carlitos Lv 1 1 pt. 3,821
  9. Avatar for ZeroLeak7 189. ZeroLeak7 Lv 1 1 pt. 3,821
  10. Avatar for Arthemian 190. Arthemian Lv 1 1 pt. 3,821

Comments