Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516

  1. Avatar for manu8170 41. manu8170 Lv 1 32 pts. 9,835
  2. Avatar for phi16 42. phi16 Lv 1 31 pts. 9,766
  3. Avatar for jamiexq 43. jamiexq Lv 1 30 pts. 9,762
  4. Avatar for bamh 44. bamh Lv 1 29 pts. 9,744
  5. Avatar for ucad 45. ucad Lv 1 28 pts. 9,738
  6. Avatar for Oransche 46. Oransche Lv 1 27 pts. 9,720
  7. Avatar for heather-1 47. heather-1 Lv 1 27 pts. 9,714
  8. Avatar for PeterDav 48. PeterDav Lv 1 26 pts. 9,714
  9. Avatar for vuvuvu 49. vuvuvu Lv 1 25 pts. 9,627
  10. Avatar for aendgraend 50. aendgraend Lv 1 24 pts. 9,609

Comments