Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516
  1. Avatar for jobo0502 11. jobo0502 Lv 1 77 pts. 10,294
  2. Avatar for g_b 12. g_b Lv 1 75 pts. 10,291
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 73 pts. 10,259
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 71 pts. 10,251
  5. Avatar for Galaxie 15. Galaxie Lv 1 69 pts. 10,191
  6. Avatar for Deleted player 16. Deleted player pts. 10,181
  7. Avatar for Punzi Baker 2 17. Punzi Baker 2 Lv 1 66 pts. 10,170
  8. Avatar for guineapig 18. guineapig Lv 1 64 pts. 10,150
  9. Avatar for MicElephant 19. MicElephant Lv 1 62 pts. 10,143
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 60 pts. 10,139

Comments