Placeholder image of a protein
Icon representing a puzzle

2083: Revisiting Puzzle 94: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,505
  2. Avatar for Contenders 2. Contenders 74 pts. 10,477
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,435
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,425
  5. Avatar for Go Science 5. Go Science 27 pts. 10,412
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,374
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,139
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 9,627
  9. Avatar for SETI.Germany 9. SETI.Germany 5 pts. 9,609
  10. Avatar for Australia 10. Australia 3 pts. 9,516
  1. Avatar for kyoota 61. kyoota Lv 1 16 pts. 9,328
  2. Avatar for Todd6485577 62. Todd6485577 Lv 1 16 pts. 9,312
  3. Avatar for Larini 63. Larini Lv 1 15 pts. 9,299
  4. Avatar for Simek 64. Simek Lv 1 15 pts. 9,287
  5. Avatar for vybi 65. vybi Lv 1 14 pts. 9,116
  6. Avatar for Actinote01 66. Actinote01 Lv 1 14 pts. 9,109
  7. Avatar for DScott 67. DScott Lv 1 13 pts. 9,107
  8. Avatar for kevin everington 68. kevin everington Lv 1 13 pts. 9,107
  9. Avatar for Dr.Sillem 69. Dr.Sillem Lv 1 12 pts. 9,084
  10. Avatar for Arne Heessels 70. Arne Heessels Lv 1 12 pts. 9,078

Comments