Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for MirsadaH 91. MirsadaH Lv 1 3 pts. 9,185
  2. Avatar for DScott 92. DScott Lv 1 3 pts. 9,181
  3. Avatar for kludbrook 93. kludbrook Lv 1 3 pts. 9,176
  4. Avatar for kentish_alex 94. kentish_alex Lv 1 3 pts. 9,170
  5. Avatar for seilgu 95. seilgu Lv 1 3 pts. 9,161
  6. Avatar for bmosxop 96. bmosxop Lv 1 3 pts. 9,153
  7. Avatar for antibot215 97. antibot215 Lv 1 2 pts. 9,148
  8. Avatar for PacificScienceCenter 98. PacificScienceCenter Lv 1 2 pts. 9,142
  9. Avatar for lucianok21 99. lucianok21 Lv 1 2 pts. 9,132
  10. Avatar for Victor535434 100. Victor535434 Lv 1 2 pts. 9,127

Comments