Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for Hebrew Hitman 101. Hebrew Hitman Lv 1 2 pts. 9,121
  2. Avatar for Gab27 102. Gab27 Lv 1 2 pts. 9,116
  3. Avatar for Sandrix72 103. Sandrix72 Lv 1 2 pts. 9,112
  4. Avatar for calhagar 104. calhagar Lv 1 2 pts. 9,085
  5. Avatar for Swapper242 105. Swapper242 Lv 1 2 pts. 9,084
  6. Avatar for zo3xiaJonWeinberg 106. zo3xiaJonWeinberg Lv 1 2 pts. 9,079
  7. Avatar for 2014CJ9408 107. 2014CJ9408 Lv 1 1 pt. 9,059
  8. Avatar for LeoniDDT 108. LeoniDDT Lv 1 1 pt. 9,048
  9. Avatar for Ell_ 109. Ell_ Lv 1 1 pt. 9,044
  10. Avatar for alths 110. alths Lv 1 1 pt. 9,035

Comments