Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for Eumene 111. Eumene Lv 1 1 pt. 9,022
  2. Avatar for jhonangel12 112. jhonangel12 Lv 1 1 pt. 9,016
  3. Avatar for hada 113. hada Lv 1 1 pt. 8,993
  4. Avatar for nicklockwood 114. nicklockwood Lv 1 1 pt. 8,986
  5. Avatar for Matias SG 115. Matias SG Lv 1 1 pt. 8,982
  6. Avatar for Sammy3c2b1a0 116. Sammy3c2b1a0 Lv 1 1 pt. 8,966
  7. Avatar for asb4 117. asb4 Lv 1 1 pt. 8,928
  8. Avatar for Hellcat6 118. Hellcat6 Lv 1 1 pt. 8,891
  9. Avatar for rzrbladess 119. rzrbladess Lv 1 1 pt. 8,886
  10. Avatar for hwelhaven 120. hwelhaven Lv 1 1 pt. 8,882

Comments