Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for sethkelly 121. sethkelly Lv 1 1 pt. 8,877
  2. Avatar for RAH 122. RAH Lv 1 1 pt. 8,842
  3. Avatar for furi0us 123. furi0us Lv 1 1 pt. 8,834
  4. Avatar for mart0258 124. mart0258 Lv 1 1 pt. 8,828
  5. Avatar for Jamil23 125. Jamil23 Lv 1 1 pt. 8,815
  6. Avatar for lickington 126. lickington Lv 1 1 pt. 8,809
  7. Avatar for rianehuang 127. rianehuang Lv 1 1 pt. 8,746
  8. Avatar for Deleted player 128. Deleted player 1 pt. 8,727
  9. Avatar for navyred 129. navyred Lv 1 1 pt. 8,727
  10. Avatar for chaperoneKaty 130. chaperoneKaty Lv 1 1 pt. 8,647

Comments