Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for hseeber01 141. hseeber01 Lv 1 1 pt. 7,816
  2. Avatar for Sartan98 142. Sartan98 Lv 1 1 pt. 7,719
  3. Avatar for Susume 143. Susume Lv 1 1 pt. 7,664
  4. Avatar for SW235 144. SW235 Lv 1 1 pt. 7,244
  5. Avatar for Karley01 145. Karley01 Lv 1 1 pt. 7,122
  6. Avatar for vgrifford 146. vgrifford Lv 1 1 pt. 7,083
  7. Avatar for dolphin0104 147. dolphin0104 Lv 1 1 pt. 7,075
  8. Avatar for tjarmstro 148. tjarmstro Lv 1 1 pt. 7,061
  9. Avatar for sandiax 149. sandiax Lv 1 1 pt. 7,047
  10. Avatar for SHK5P 150. SHK5P Lv 1 1 pt. 7,023

Comments