Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for joshmiller 151. joshmiller Lv 1 1 pt. 6,972
  2. Avatar for EME93 152. EME93 Lv 1 1 pt. 6,930
  3. Avatar for leckseyy 153. leckseyy Lv 1 1 pt. 6,918
  4. Avatar for Agustin habib 154. Agustin habib Lv 1 1 pt. 6,908
  5. Avatar for ewirtala 155. ewirtala Lv 1 1 pt. 6,779
  6. Avatar for Ioannis_Ms 156. Ioannis_Ms Lv 1 1 pt. 6,752
  7. Avatar for Tasneem Bamboowala 157. Tasneem Bamboowala Lv 1 1 pt. 6,740
  8. Avatar for Dr.Bilipro 158. Dr.Bilipro Lv 1 1 pt. 6,085
  9. Avatar for tanish 159. tanish Lv 1 1 pt. 5,048
  10. Avatar for allynmuzhixu 160. allynmuzhixu Lv 1 1 pt. 5,020

Comments