Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for apetrides 161. apetrides Lv 1 1 pt. 5,020
  2. Avatar for joshtest01 162. joshtest01 Lv 1 1 pt. 5,020
  3. Avatar for Bwags10 163. Bwags10 Lv 1 1 pt. 5,020
  4. Avatar for dambistearoom 164. dambistearoom Lv 1 1 pt. 5,020
  5. Avatar for Liron 165. Liron Lv 1 1 pt. 5,020
  6. Avatar for cjddig 166. cjddig Lv 1 1 pt. 5,020
  7. Avatar for Chloe JB 167. Chloe JB Lv 1 1 pt. 5,020
  8. Avatar for Sciren 168. Sciren Lv 1 1 pt. 5,020
  9. Avatar for Cyberkashi 169. Cyberkashi Lv 1 1 pt. 5,020
  10. Avatar for MEJOW 170. MEJOW Lv 1 1 pt. 5,020

Comments