Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for test 2 17. test 2 1 pt. 5,020

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 75 pts. 9,749
  2. Avatar for guineapig 12. guineapig Lv 1 73 pts. 9,747
  3. Avatar for robgee 13. robgee Lv 1 71 pts. 9,742
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 69 pts. 9,741
  5. Avatar for Deleted player 15. Deleted player pts. 9,739
  6. Avatar for Blipperman 16. Blipperman Lv 1 65 pts. 9,728
  7. Avatar for RockOn 17. RockOn Lv 1 63 pts. 9,722
  8. Avatar for MicElephant 18. MicElephant Lv 1 61 pts. 9,718
  9. Avatar for Alistair69 19. Alistair69 Lv 1 59 pts. 9,718
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 57 pts. 9,712

Comments