Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for georg137 21. georg137 Lv 1 55 pts. 9,709
  2. Avatar for Arthuriel 22. Arthuriel Lv 1 53 pts. 9,706
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 52 pts. 9,703
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 50 pts. 9,701
  5. Avatar for jausmh 25. jausmh Lv 1 49 pts. 9,700
  6. Avatar for WBarme1234 26. WBarme1234 Lv 1 47 pts. 9,693
  7. Avatar for Deleted player 27. Deleted player 45 pts. 9,661
  8. Avatar for silent gene 28. silent gene Lv 1 44 pts. 9,655
  9. Avatar for jamiexq 29. jamiexq Lv 1 43 pts. 9,650
  10. Avatar for BootsMcGraw 30. BootsMcGraw Lv 1 41 pts. 9,646

Comments