Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for alcor29 31. alcor29 Lv 1 40 pts. 9,630
  2. Avatar for zippyc137 32. zippyc137 Lv 1 38 pts. 9,628
  3. Avatar for Vinara 33. Vinara Lv 1 37 pts. 9,621
  4. Avatar for Lotus23 34. Lotus23 Lv 1 36 pts. 9,614
  5. Avatar for AlphaFold2 35. AlphaFold2 Lv 1 35 pts. 9,613
  6. Avatar for manu8170 36. manu8170 Lv 1 34 pts. 9,613
  7. Avatar for frood66 37. frood66 Lv 1 32 pts. 9,608
  8. Avatar for ucad 38. ucad Lv 1 31 pts. 9,598
  9. Avatar for PeterDav 39. PeterDav Lv 1 30 pts. 9,577
  10. Avatar for NPrincipi 40. NPrincipi Lv 1 29 pts. 9,566

Comments