Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for test 2 17. test 2 1 pt. 5,020

  1. Avatar for maithra 41. maithra Lv 1 28 pts. 9,549
  2. Avatar for AlkiP0Ps 42. AlkiP0Ps Lv 1 27 pts. 9,549
  3. Avatar for Zosa 43. Zosa Lv 1 26 pts. 9,543
  4. Avatar for zackallen 44. zackallen Lv 1 25 pts. 9,526
  5. Avatar for fpc 45. fpc Lv 1 24 pts. 9,522
  6. Avatar for heather-1 46. heather-1 Lv 1 23 pts. 9,519
  7. Avatar for BarrySampson 47. BarrySampson Lv 1 22 pts. 9,504
  8. Avatar for Visok 48. Visok Lv 1 22 pts. 9,503
  9. Avatar for gurch 49. gurch Lv 1 21 pts. 9,503
  10. Avatar for Oransche 50. Oransche Lv 1 20 pts. 9,502

Comments