Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for equilibria 61. equilibria Lv 1 13 pts. 9,444
  2. Avatar for Wiz kid 62. Wiz kid Lv 1 12 pts. 9,443
  3. Avatar for latin krepin 63. latin krepin Lv 1 12 pts. 9,436
  4. Avatar for Altercomp 64. Altercomp Lv 1 11 pts. 9,432
  5. Avatar for deus911 65. deus911 Lv 1 11 pts. 9,429
  6. Avatar for A Fellow Human 66. A Fellow Human Lv 1 10 pts. 9,428
  7. Avatar for Trajan464 67. Trajan464 Lv 1 10 pts. 9,411
  8. Avatar for Larini 68. Larini Lv 1 10 pts. 9,400
  9. Avatar for bamh 69. bamh Lv 1 9 pts. 9,399
  10. Avatar for kevin everington 70. kevin everington Lv 1 9 pts. 9,397

Comments