Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for carxo 71. carxo Lv 1 8 pts. 9,393
  2. Avatar for ProfVince 72. ProfVince Lv 1 8 pts. 9,382
  3. Avatar for NeLikomSheet 73. NeLikomSheet Lv 1 8 pts. 9,370
  4. Avatar for Dr.Sillem 74. Dr.Sillem Lv 1 7 pts. 9,364
  5. Avatar for infjamc 75. infjamc Lv 1 7 pts. 9,357
  6. Avatar for tracybutt 76. tracybutt Lv 1 7 pts. 9,350
  7. Avatar for cherry39 77. cherry39 Lv 1 6 pts. 9,349
  8. Avatar for abiogenesis 78. abiogenesis Lv 1 6 pts. 9,321
  9. Avatar for Amynet 79. Amynet Lv 1 6 pts. 9,314
  10. Avatar for kyoota 80. kyoota Lv 1 6 pts. 9,312

Comments