Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for Mohoernchen 81. Mohoernchen Lv 1 5 pts. 9,275
  2. Avatar for rinze 82. rinze Lv 1 5 pts. 9,259
  3. Avatar for Evica 83. Evica Lv 1 5 pts. 9,251
  4. Avatar for pruneau_44 84. pruneau_44 Lv 1 5 pts. 9,237
  5. Avatar for Alex333 85. Alex333 Lv 1 4 pts. 9,237
  6. Avatar for Maximus150 86. Maximus150 Lv 1 4 pts. 9,224
  7. Avatar for argyrw 87. argyrw Lv 1 4 pts. 9,215
  8. Avatar for PhoebeDillon 88. PhoebeDillon Lv 1 4 pts. 9,212
  9. Avatar for JOE.CADILLAC555 89. JOE.CADILLAC555 Lv 1 4 pts. 9,206
  10. Avatar for Jrothenberg 90. Jrothenberg Lv 1 3 pts. 9,191

Comments