Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,873
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 9,869
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,839
  4. Avatar for Go Science 4. Go Science 36 pts. 9,838
  5. Avatar for Contenders 5. Contenders 24 pts. 9,814
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,735
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,728
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,712
  9. Avatar for AlphaFold 9. AlphaFold 4 pts. 9,613
  10. Avatar for Australia 10. Australia 2 pts. 9,549
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,855
  2. Avatar for phi16 2. phi16 Lv 1 68 pts. 9,843
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 44 pts. 9,838
  4. Avatar for gmn 4. gmn Lv 1 27 pts. 9,838
  5. Avatar for LociOiling 5. LociOiling Lv 1 16 pts. 9,838
  6. Avatar for maithra 6. maithra Lv 1 9 pts. 9,814
  7. Avatar for silent gene 7. silent gene Lv 1 5 pts. 9,813
  8. Avatar for alcor29 8. alcor29 Lv 1 3 pts. 9,764
  9. Avatar for jamiexq 9. jamiexq Lv 1 1 pt. 9,751
  10. Avatar for fpc 10. fpc Lv 1 1 pt. 9,735

Comments