Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 9,873
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 9,869
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,839
  4. Avatar for Go Science 4. Go Science 36 pts. 9,838
  5. Avatar for Contenders 5. Contenders 24 pts. 9,814
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,735
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,728
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,712
  9. Avatar for AlphaFold 9. AlphaFold 4 pts. 9,613
  10. Avatar for Australia 10. Australia 2 pts. 9,549
  1. Avatar for Sciren 171. Sciren Lv 1 1 pt. 5,020
  2. Avatar for Cyberkashi 172. Cyberkashi Lv 1 1 pt. 5,020
  3. Avatar for MEJOW 173. MEJOW Lv 1 1 pt. 5,020
  4. Avatar for burgessmargaret 174. burgessmargaret Lv 1 1 pt. 5,020
  5. Avatar for bkoep 175. bkoep Lv 1 1 pt. 5,020
  6. Avatar for kaylut 176. kaylut Lv 1 1 pt. 5,020
  7. Avatar for mbaratal 177. mbaratal Lv 1 1 pt. 5,020

Comments