Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Otterbein Bioinformatics 2022 11. Otterbein Bioinformatics 2022 1 pt. 9,280
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  3. Avatar for Team China 13. Team China 1 pt. 9,008
  4. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520
  5. Avatar for Mustang AP Biology 2022 15. Mustang AP Biology 2022 1 pt. 5,520
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,963
  2. Avatar for LociOiling 2. LociOiling Lv 1 65 pts. 10,849
  3. Avatar for Galaxie 3. Galaxie Lv 1 41 pts. 10,842
  4. Avatar for robgee 4. robgee Lv 1 24 pts. 10,826
  5. Avatar for fpc 5. fpc Lv 1 14 pts. 10,786
  6. Avatar for maithra 6. maithra Lv 1 7 pts. 10,760
  7. Avatar for gmn 7. gmn Lv 1 4 pts. 10,756
  8. Avatar for alcor29 8. alcor29 Lv 1 2 pts. 10,691
  9. Avatar for Arthuriel 9. Arthuriel Lv 1 1 pt. 10,678
  10. Avatar for Oransche 10. Oransche Lv 1 1 pt. 10,655

Comments