Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  2. Avatar for Team China 13. Team China 1 pt. 9,008
  3. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,960
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,848
  3. Avatar for robgee 3. robgee Lv 1 94 pts. 10,831
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 90 pts. 10,818
  5. Avatar for BootsMcGraw 5. BootsMcGraw Lv 1 87 pts. 10,786
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 84 pts. 10,783
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 81 pts. 10,778
  8. Avatar for Galaxie 8. Galaxie Lv 1 78 pts. 10,776
  9. Avatar for jausmh 9. jausmh Lv 1 75 pts. 10,727
  10. Avatar for ucad 10. ucad Lv 1 72 pts. 10,721

Comments