Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Otterbein Bioinformatics 2022 11. Otterbein Bioinformatics 2022 1 pt. 9,280
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  3. Avatar for Team China 13. Team China 1 pt. 9,008
  4. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520
  5. Avatar for Mustang AP Biology 2022 15. Mustang AP Biology 2022 1 pt. 5,520
  1. Avatar for Deleted player 31. Deleted player pts. 10,484
  2. Avatar for dizzywings 32. dizzywings Lv 1 29 pts. 10,452
  3. Avatar for MicElephant 33. MicElephant Lv 1 28 pts. 10,436
  4. Avatar for Arthuriel 34. Arthuriel Lv 1 27 pts. 10,434
  5. Avatar for RockOn 35. RockOn Lv 1 25 pts. 10,432
  6. Avatar for equilibria 36. equilibria Lv 1 24 pts. 10,415
  7. Avatar for j.wohlmann 37. j.wohlmann Lv 1 23 pts. 10,413
  8. Avatar for alcor29 38. alcor29 Lv 1 22 pts. 10,411
  9. Avatar for grogar7 39. grogar7 Lv 1 21 pts. 10,410
  10. Avatar for jamiexq 40. jamiexq Lv 1 20 pts. 10,407

Comments