Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  2. Avatar for Team China 13. Team China 1 pt. 9,008
  3. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520

  1. Avatar for Skippysk8s 41. Skippysk8s Lv 1 19 pts. 10,406
  2. Avatar for Vinara 42. Vinara Lv 1 18 pts. 10,404
  3. Avatar for Zosa 43. Zosa Lv 1 17 pts. 10,401
  4. Avatar for Visok 44. Visok Lv 1 16 pts. 10,372
  5. Avatar for dam_01 45. dam_01 Lv 1 16 pts. 10,365
  6. Avatar for PeterDav 46. PeterDav Lv 1 15 pts. 10,350
  7. Avatar for zippyc137 47. zippyc137 Lv 1 14 pts. 10,331
  8. Avatar for ShadowTactics 48. ShadowTactics Lv 1 13 pts. 10,305
  9. Avatar for maithra 49. maithra Lv 1 13 pts. 10,283
  10. Avatar for Deleted player 50. Deleted player pts. 10,281

Comments