Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Otterbein Bioinformatics 2022 11. Otterbein Bioinformatics 2022 1 pt. 9,280
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  3. Avatar for Team China 13. Team China 1 pt. 9,008
  4. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520
  5. Avatar for Mustang AP Biology 2022 15. Mustang AP Biology 2022 1 pt. 5,520
  1. Avatar for bamh 61. bamh Lv 1 7 pts. 10,083
  2. Avatar for pfirth 62. pfirth Lv 1 6 pts. 10,060
  3. Avatar for ProfVince 63. ProfVince Lv 1 6 pts. 10,053
  4. Avatar for rezaefar 64. rezaefar Lv 1 6 pts. 10,004
  5. Avatar for carxo 65. carxo Lv 1 5 pts. 9,998
  6. Avatar for AlkiP0Ps 66. AlkiP0Ps Lv 1 5 pts. 9,953
  7. Avatar for Vincera 67. Vincera Lv 1 5 pts. 9,944
  8. Avatar for Dr.Sillem 68. Dr.Sillem Lv 1 4 pts. 9,927
  9. Avatar for DScott 69. DScott Lv 1 4 pts. 9,915
  10. Avatar for Larini 70. Larini Lv 1 4 pts. 9,915

Comments