Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Otterbein Bioinformatics 2022 11. Otterbein Bioinformatics 2022 1 pt. 9,280
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  3. Avatar for Team China 13. Team China 1 pt. 9,008
  4. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520
  5. Avatar for Mustang AP Biology 2022 15. Mustang AP Biology 2022 1 pt. 5,520
  1. Avatar for Oransche 71. Oransche Lv 1 4 pts. 9,879
  2. Avatar for abiogenesis 72. abiogenesis Lv 1 3 pts. 9,844
  3. Avatar for wosser1 73. wosser1 Lv 1 3 pts. 9,823
  4. Avatar for tracybutt 74. tracybutt Lv 1 3 pts. 9,776
  5. Avatar for Merf 75. Merf Lv 1 3 pts. 9,720
  6. Avatar for heyubob 76. heyubob Lv 1 3 pts. 9,711
  7. Avatar for kyoota 77. kyoota Lv 1 2 pts. 9,666
  8. Avatar for Altercomp 78. Altercomp Lv 1 2 pts. 9,595
  9. Avatar for Wiz kid 79. Wiz kid Lv 1 2 pts. 9,591
  10. Avatar for Hellcat6 80. Hellcat6 Lv 1 2 pts. 9,585

Comments