Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953

  1. Avatar for evifnoskcaj 101. evifnoskcaj Lv 1 1 pt. 9,112
  2. Avatar for DanieleCurto 102. DanieleCurto Lv 1 1 pt. 9,111
  3. Avatar for Swapper242 103. Swapper242 Lv 1 1 pt. 9,107
  4. Avatar for furi0us 104. furi0us Lv 1 1 pt. 9,105
  5. Avatar for Hebrew Hitman 105. Hebrew Hitman Lv 1 1 pt. 9,030
  6. Avatar for zo3xiaJonWeinberg 106. zo3xiaJonWeinberg Lv 1 1 pt. 9,008
  7. Avatar for zhengjialin 107. zhengjialin Lv 1 1 pt. 8,824
  8. Avatar for moleculeman 108. moleculeman Lv 1 1 pt. 8,617
  9. Avatar for CB21wolf 109. CB21wolf Lv 1 1 pt. 8,616
  10. Avatar for fpc 110. fpc Lv 1 1 pt. 8,349

Comments