Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953

  1. Avatar for imgil25 131. imgil25 Lv 1 1 pt. 5,520
  2. Avatar for pp3ndwich 132. pp3ndwich Lv 1 1 pt. 5,520
  3. Avatar for digpitch 133. digpitch Lv 1 1 pt. 5,520
  4. Avatar for klbklb 134. klbklb Lv 1 1 pt. 5,520
  5. Avatar for JellyJump 135. JellyJump Lv 1 1 pt. 5,520
  6. Avatar for choana2022 136. choana2022 Lv 1 1 pt. 5,520
  7. Avatar for abhitipu 137. abhitipu Lv 1 1 pt. 5,520
  8. Avatar for kpmcintosh 138. kpmcintosh Lv 1 1 pt. 5,520
  9. Avatar for philipos 139. philipos Lv 1 1 pt. 5,520
  10. Avatar for sakshamphul 140. sakshamphul Lv 1 1 pt. 5,520

Comments