Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953

  1. Avatar for Deleted player 31. Deleted player pts. 10,484
  2. Avatar for dizzywings 32. dizzywings Lv 1 29 pts. 10,452
  3. Avatar for MicElephant 33. MicElephant Lv 1 28 pts. 10,436
  4. Avatar for Arthuriel 34. Arthuriel Lv 1 27 pts. 10,434
  5. Avatar for RockOn 35. RockOn Lv 1 25 pts. 10,432
  6. Avatar for equilibria 36. equilibria Lv 1 24 pts. 10,415
  7. Avatar for j.wohlmann 37. j.wohlmann Lv 1 23 pts. 10,413
  8. Avatar for alcor29 38. alcor29 Lv 1 22 pts. 10,411
  9. Avatar for grogar7 39. grogar7 Lv 1 21 pts. 10,410
  10. Avatar for jamiexq 40. jamiexq Lv 1 20 pts. 10,407

Comments