Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  3. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552

  1. Avatar for jausmh
    1. jausmh Lv 1
    100 pts. 20,122
  2. Avatar for Oransche 2. Oransche Lv 1 74 pts. 20,092
  3. Avatar for fpc 3. fpc Lv 1 54 pts. 20,067
  4. Avatar for frood66 4. frood66 Lv 1 38 pts. 20,037
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 27 pts. 20,032
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 18 pts. 20,030
  7. Avatar for Lotus23 7. Lotus23 Lv 1 12 pts. 20,030
  8. Avatar for LociOiling 8. LociOiling Lv 1 8 pts. 19,990
  9. Avatar for maithra 9. maithra Lv 1 5 pts. 19,968
  10. Avatar for Cyberkashi 10. Cyberkashi Lv 1 3 pts. 19,930

Comments