Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for MariaS5. 91. MariaS5. Lv 1 1 pt. 5,906
  2. Avatar for Susume 92. Susume Lv 1 1 pt. 5,618
  3. Avatar for agcohn821 93. agcohn821 Lv 1 1 pt. 5,552
  4. Avatar for cgyeow 94. cgyeow Lv 1 1 pt. 5,552
  5. Avatar for coler24 95. coler24 Lv 1 1 pt. 5,552
  6. Avatar for aidencosta 96. aidencosta Lv 1 1 pt. 5,552
  7. Avatar for Viacheslav1985 97. Viacheslav1985 Lv 1 1 pt. 5,552
  8. Avatar for asmith4052 98. asmith4052 Lv 1 1 pt. 5,552
  9. Avatar for GreenR 99. GreenR Lv 1 1 pt. 5,552
  10. Avatar for PacificScienceCenter 100. PacificScienceCenter Lv 1 1 pt. 5,552

Comments