Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 35 pts. 19,652
  2. Avatar for gmn 22. gmn Lv 1 33 pts. 19,646
  3. Avatar for alcor29 23. alcor29 Lv 1 31 pts. 19,635
  4. Avatar for robgee 24. robgee Lv 1 30 pts. 19,583
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 28 pts. 19,552
  6. Avatar for j.wohlmann 26. j.wohlmann Lv 1 26 pts. 19,530
  7. Avatar for manu8170 27. manu8170 Lv 1 25 pts. 19,520
  8. Avatar for akaaka 28. akaaka Lv 1 23 pts. 19,502
  9. Avatar for Cyberkashi 29. Cyberkashi Lv 1 22 pts. 19,497
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 20 pts. 19,478

Comments