Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for Merf 41. Merf Lv 1 10 pts. 19,268
  2. Avatar for NeLikomSheet 42. NeLikomSheet Lv 1 9 pts. 19,258
  3. Avatar for sgeldhof 43. sgeldhof Lv 1 8 pts. 19,248
  4. Avatar for Oransche 44. Oransche Lv 1 8 pts. 19,246
  5. Avatar for infjamc 45. infjamc Lv 1 7 pts. 19,212
  6. Avatar for Blipperman 46. Blipperman Lv 1 7 pts. 19,117
  7. Avatar for Trajan464 47. Trajan464 Lv 1 6 pts. 19,069
  8. Avatar for HuubR 48. HuubR Lv 1 6 pts. 19,041
  9. Avatar for bamh 49. bamh Lv 1 5 pts. 19,026
  10. Avatar for Lotus23 50. Lotus23 Lv 1 5 pts. 18,967

Comments