Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for cjddig 61. cjddig Lv 1 2 pts. 18,543
  2. Avatar for Larini 62. Larini Lv 1 2 pts. 18,508
  3. Avatar for froschi2 63. froschi2 Lv 1 2 pts. 18,499
  4. Avatar for dam_01 64. dam_01 Lv 1 2 pts. 18,466
  5. Avatar for tracybutt 65. tracybutt Lv 1 1 pt. 18,462
  6. Avatar for spvincent 66. spvincent Lv 1 1 pt. 18,450
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 1 pt. 18,387
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 1 pt. 18,386
  9. Avatar for DScott 69. DScott Lv 1 1 pt. 18,321
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 18,306

Comments