Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for pruneau_44 71. pruneau_44 Lv 1 1 pt. 18,303
  2. Avatar for Hebrew Hitman 72. Hebrew Hitman Lv 1 1 pt. 18,254
  3. Avatar for furi0us 73. furi0us Lv 1 1 pt. 18,246
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 18,243
  5. Avatar for BarneyE 75. BarneyE Lv 1 1 pt. 18,231
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 18,210
  7. Avatar for 102023148930275923 77. 102023148930275923 Lv 1 1 pt. 18,159
  8. Avatar for MikeeG 78. MikeeG Lv 1 1 pt. 18,110
  9. Avatar for Sammy3c2b1a0 79. Sammy3c2b1a0 Lv 1 1 pt. 18,096
  10. Avatar for henghesha 80. henghesha Lv 1 1 pt. 18,090

Comments