Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for jausmh
    1. jausmh Lv 1
    100 pts. 20,122
  2. Avatar for Oransche 2. Oransche Lv 1 74 pts. 20,092
  3. Avatar for fpc 3. fpc Lv 1 54 pts. 20,067
  4. Avatar for frood66 4. frood66 Lv 1 38 pts. 20,037
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 27 pts. 20,032
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 18 pts. 20,030
  7. Avatar for Lotus23 7. Lotus23 Lv 1 12 pts. 20,030
  8. Avatar for LociOiling 8. LociOiling Lv 1 8 pts. 19,990
  9. Avatar for maithra 9. maithra Lv 1 5 pts. 19,968
  10. Avatar for Cyberkashi 10. Cyberkashi Lv 1 3 pts. 19,930

Comments