Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for andrew081987 111. andrew081987 Lv 1 1 pt. 8,973
  2. Avatar for ThElektro 112. ThElektro Lv 1 1 pt. 8,957
  3. Avatar for logan odonnell 113. logan odonnell Lv 1 1 pt. 8,914
  4. Avatar for Maha4learning 114. Maha4learning Lv 1 1 pt. 8,908
  5. Avatar for Ayushr 115. Ayushr Lv 1 1 pt. 8,705
  6. Avatar for Ahmad Zaher 116. Ahmad Zaher Lv 1 1 pt. 8,690
  7. Avatar for abskebabs 117. abskebabs Lv 1 1 pt. 8,664
  8. Avatar for Elenacoronilla 118. Elenacoronilla Lv 1 1 pt. 8,522
  9. Avatar for Reuben_Allen 119. Reuben_Allen Lv 1 1 pt. 8,449
  10. Avatar for Gematron 2874 120. Gematron 2874 Lv 1 1 pt. 8,428

Comments