Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for pradnya 151. pradnya Lv 1 1 pt. 6,348
  2. Avatar for phi16 152. phi16 Lv 1 1 pt. 6,348
  3. Avatar for snoe 153. snoe Lv 1 1 pt. 6,348
  4. Avatar for christyy_le 154. christyy_le Lv 1 1 pt. 6,348
  5. Avatar for Wolfie1985 155. Wolfie1985 Lv 1 1 pt. 6,348
  6. Avatar for KosarRahimi 156. KosarRahimi Lv 1 1 pt. 6,348
  7. Avatar for HuubR 157. HuubR Lv 1 1 pt. 6,348
  8. Avatar for kcamacho 158. kcamacho Lv 1 1 pt. 6,348
  9. Avatar for rshirali 159. rshirali Lv 1 1 pt. 6,348
  10. Avatar for jeyster 160. jeyster Lv 1 1 pt. 6,348

Comments