Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for ciccirico 161. ciccirico Lv 1 1 pt. 6,348
  2. Avatar for FestiveHarith 162. FestiveHarith Lv 1 1 pt. 6,348
  3. Avatar for Deleted player 163. Deleted player 1 pt. 6,348
  4. Avatar for fpc 164. fpc Lv 1 1 pt. 6,348
  5. Avatar for davidghsk 165. davidghsk Lv 1 1 pt. 6,348
  6. Avatar for WilliamTM 166. WilliamTM Lv 1 1 pt. 6,348
  7. Avatar for TheCoper0880 167. TheCoper0880 Lv 1 1 pt. 6,348
  8. Avatar for malekzadeh_karim 168. malekzadeh_karim Lv 1 1 pt. 6,348
  9. Avatar for nsub26 169. nsub26 Lv 1 1 pt. 6,348
  10. Avatar for erbstoesserm2022 170. erbstoesserm2022 Lv 1 1 pt. 6,348

Comments