Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for alcor29 11. alcor29 Lv 1 75 pts. 11,091
  2. Avatar for guineapig 12. guineapig Lv 1 73 pts. 11,033
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 70 pts. 11,029
  4. Avatar for georg137 14. georg137 Lv 1 68 pts. 11,018
  5. Avatar for g_b 15. g_b Lv 1 66 pts. 11,015
  6. Avatar for MicElephant 16. MicElephant Lv 1 64 pts. 11,014
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 62 pts. 11,013
  8. Avatar for Skippysk8s 18. Skippysk8s Lv 1 60 pts. 11,013
  9. Avatar for akaaka 19. akaaka Lv 1 58 pts. 10,976
  10. Avatar for jobo0502 20. jobo0502 Lv 1 56 pts. 10,975

Comments