Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for test 2 17. test 2 1 pt. 6,348
  7. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348

  1. Avatar for BarrySampson 31. BarrySampson Lv 1 39 pts. 10,841
  2. Avatar for Lotus23 32. Lotus23 Lv 1 38 pts. 10,786
  3. Avatar for ProfVince 33. ProfVince Lv 1 36 pts. 10,766
  4. Avatar for NeLikomSheet 34. NeLikomSheet Lv 1 35 pts. 10,766
  5. Avatar for RockOn 35. RockOn Lv 1 34 pts. 10,755
  6. Avatar for Arthuriel 36. Arthuriel Lv 1 33 pts. 10,734
  7. Avatar for zippyc137 37. zippyc137 Lv 1 32 pts. 10,723
  8. Avatar for Punzi Baker 2 38. Punzi Baker 2 Lv 1 31 pts. 10,697
  9. Avatar for bamh 39. bamh Lv 1 29 pts. 10,623
  10. Avatar for equilibria 40. equilibria Lv 1 28 pts. 10,621

Comments