Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for test 2 17. test 2 1 pt. 6,348
  7. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348

  1. Avatar for antibot215 71. antibot215 Lv 1 8 pts. 9,504
  2. Avatar for rinze 72. rinze Lv 1 8 pts. 9,499
  3. Avatar for tracybutt 73. tracybutt Lv 1 7 pts. 9,491
  4. Avatar for raj213 74. raj213 Lv 1 7 pts. 9,452
  5. Avatar for froschi2 75. froschi2 Lv 1 7 pts. 9,446
  6. Avatar for DScott 76. DScott Lv 1 6 pts. 9,441
  7. Avatar for utkarsh_02 77. utkarsh_02 Lv 1 6 pts. 9,434
  8. Avatar for goalysniper 78. goalysniper Lv 1 6 pts. 9,402
  9. Avatar for AlphaFold2 79. AlphaFold2 Lv 1 5 pts. 9,396
  10. Avatar for mudded 80. mudded Lv 1 5 pts. 9,359

Comments