Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 28,624
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 28,597
  3. Avatar for Punzi Baker 2 3. Punzi Baker 2 Lv 1 88 pts. 28,492
  4. Avatar for jeff101 4. jeff101 Lv 1 82 pts. 28,408
  5. Avatar for gmn 5. gmn Lv 1 77 pts. 28,405
  6. Avatar for BootsMcGraw 6. BootsMcGraw Lv 1 72 pts. 28,390
  7. Avatar for Galaxie 7. Galaxie Lv 1 67 pts. 28,383
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 62 pts. 28,347
  9. Avatar for Cyberkashi 9. Cyberkashi Lv 1 58 pts. 28,324
  10. Avatar for MicElephant 10. MicElephant Lv 1 54 pts. 28,271

Comments