Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since over 4 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 28,663
  2. Avatar for LociOiling 2. LociOiling Lv 1 74 pts. 28,595
  3. Avatar for kyoota 3. kyoota Lv 1 54 pts. 28,591
  4. Avatar for Galaxie 4. Galaxie Lv 1 38 pts. 28,480
  5. Avatar for equilibria 5. equilibria Lv 1 27 pts. 28,458
  6. Avatar for gmn 6. gmn Lv 1 18 pts. 28,351
  7. Avatar for phi16 7. phi16 Lv 1 12 pts. 28,306
  8. Avatar for alcor29 8. alcor29 Lv 1 8 pts. 28,280
  9. Avatar for MicElephant 9. MicElephant Lv 1 5 pts. 28,274
  10. Avatar for guineapig 10. guineapig Lv 1 3 pts. 28,224

Comments