2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Summary

• Created: February 23, 2022
• Expires: March 04, 2022 at 23:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:

PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

• 1. Go Science 100 pts. 28,663
• 2. Anthropic Dreams 63 pts. 28,597
• 3. Beta Folders 37 pts. 28,597
• 4. Contenders 21 pts. 28,390
• 5. FamilyBarmettler 11 pts. 28,191
• 6. Marvin's bunch 5 pts. 28,171
• 7. Gargleblasters 2 pts. 27,869
• 8. L'Alliance Francophone 1 pt. 27,774
• 9. Void Crushers 1 pt. 27,495
• 10. VeFold 1 pt. 26,556

Top evolvers

• 1. Bruno Kestemont 100 pts. 28,663
• 2. LociOiling 74 pts. 28,595
• 3. kyoota 54 pts. 28,591
• 4. Galaxie 38 pts. 28,480
• 5. equilibria 27 pts. 28,458
• 6. gmn 18 pts. 28,351
• 7. phi16 12 pts. 28,306
• 8. alcor29 8 pts. 28,280
• 9. MicElephant 5 pts. 28,274
• 10. guineapig 3 pts. 28,224