Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,137
  2. Avatar for Galaxie 2. Galaxie Lv 1 68 pts. 11,111
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 44 pts. 11,106
  4. Avatar for alcor29 4. alcor29 Lv 1 27 pts. 11,084
  5. Avatar for MicElephant 5. MicElephant Lv 1 16 pts. 11,014
  6. Avatar for gmn 6. gmn Lv 1 9 pts. 11,013
  7. Avatar for kyoota 7. kyoota Lv 1 5 pts. 11,004
  8. Avatar for robgee 8. robgee Lv 1 3 pts. 11,003
  9. Avatar for phi16 9. phi16 Lv 1 1 pt. 11,003
  10. Avatar for MrZanav 10. MrZanav Lv 1 1 pt. 10,994

Comments