Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for ajaya001 91. ajaya001 Lv 1 1 pt. 9,353
  2. Avatar for Hebrew Hitman 92. Hebrew Hitman Lv 1 1 pt. 9,335
  3. Avatar for CatieKejti 93. CatieKejti Lv 1 1 pt. 9,324
  4. Avatar for jamiexq 94. jamiexq Lv 1 1 pt. 9,316
  5. Avatar for Swapper242 95. Swapper242 Lv 1 1 pt. 9,312
  6. Avatar for illex 96. illex Lv 1 1 pt. 9,311
  7. Avatar for Rensat 97. Rensat Lv 1 1 pt. 9,280
  8. Avatar for Zehua Zhang 98. Zehua Zhang Lv 1 1 pt. 9,274
  9. Avatar for kianatom 99. kianatom Lv 1 1 pt. 9,251
  10. Avatar for itjdrbi292 100. itjdrbi292 Lv 1 1 pt. 9,192

Comments