Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for gonci 111. gonci Lv 1 1 pt. 7,177
  2. Avatar for ababacan 112. ababacan Lv 1 1 pt. 7,149
  3. Avatar for aidencosta 113. aidencosta Lv 1 1 pt. 6,991
  4. Avatar for Gerardo95 114. Gerardo95 Lv 1 1 pt. 6,912
  5. Avatar for sheem9 115. sheem9 Lv 1 1 pt. 6,757
  6. Avatar for 111 116. 111 Lv 1 1 pt. 6,658
  7. Avatar for DAVID908 117. DAVID908 Lv 1 1 pt. 6,646
  8. Avatar for borattt 118. borattt Lv 1 1 pt. 6,609
  9. Avatar for enme 119. enme Lv 1 1 pt. 6,556
  10. Avatar for samuell789 120. samuell789 Lv 1 1 pt. 6,520

Comments