Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843

  1. Avatar for lanb 121. lanb Lv 1 1 pt. 6,346
  2. Avatar for Sathoff18 122. Sathoff18 Lv 1 1 pt. 5,961
  3. Avatar for Jorge052 123. Jorge052 Lv 1 1 pt. 5,854
  4. Avatar for newmra2022 124. newmra2022 Lv 1 1 pt. 5,843
  5. Avatar for Stephanie Y_X401 125. Stephanie Y_X401 Lv 1 1 pt. 5,843
  6. Avatar for anirudha_t 126. anirudha_t Lv 1 1 pt. 5,843
  7. Avatar for sherlomck_7 127. sherlomck_7 Lv 1 1 pt. 5,843
  8. Avatar for cheny495 128. cheny495 Lv 1 1 pt. 5,843
  9. Avatar for r-blaze 129. r-blaze Lv 1 1 pt. 5,843
  10. Avatar for ihr 130. ihr Lv 1 1 pt. 5,843

Comments