Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for lanb 121. lanb Lv 1 1 pt. 6,346
  2. Avatar for Sathoff18 122. Sathoff18 Lv 1 1 pt. 5,961
  3. Avatar for Jorge052 123. Jorge052 Lv 1 1 pt. 5,854
  4. Avatar for Rhowena 124. Rhowena Lv 1 1 pt. 5,843
  5. Avatar for holahola 125. holahola Lv 1 1 pt. 5,843
  6. Avatar for bamh 126. bamh Lv 1 1 pt. 5,843
  7. Avatar for malik_x 127. malik_x Lv 1 1 pt. 5,843
  8. Avatar for h702962464 128. h702962464 Lv 1 1 pt. 5,843
  9. Avatar for bkoep 129. bkoep Lv 1 1 pt. 5,843
  10. Avatar for equilibria 130. equilibria Lv 1 1 pt. 5,843

Comments