Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for MythicalPingu 131. MythicalPingu Lv 1 1 pt. 5,843
  2. Avatar for manu8170 132. manu8170 Lv 1 1 pt. 5,843
  3. Avatar for Execute X 133. Execute X Lv 1 1 pt. 5,843
  4. Avatar for zqq123 134. zqq123 Lv 1 1 pt. 5,843
  5. Avatar for Clement Wong 135. Clement Wong Lv 1 1 pt. 5,843
  6. Avatar for rmoretti 136. rmoretti Lv 1 1 pt. 5,843
  7. Avatar for cinnik 137. cinnik Lv 1 1 pt. 5,843
  8. Avatar for NPrincipi 138. NPrincipi Lv 1 1 pt. 5,843
  9. Avatar for Jdoucette019 139. Jdoucette019 Lv 1 1 pt. 5,843
  10. Avatar for 808Applesauce 140. 808Applesauce Lv 1 1 pt. 5,843

Comments